LL-37: The Human Body's Only Cathelicidin and a Multifunctional Defense Peptide for Infection, Inflammation, and Tissue Repair

LL-37 is the sole cathelicidin antimicrobial peptide produced by the human body, functioning simultaneously as a broad-spectrum pathogen killer, immune system modulator, and tissue regeneration signal that becomes critically relevant in the era of antibiotic-resistant infection.

LL-37: The Human Body's Only Cathelicidin and a Multifunctional Defense Peptide for Infection, Inflammation, and Tissue Repair

Discovery and Background

LL-37 is a 37-amino acid cationic peptide with the sequence [LL-37, 37 aa], encoded by the CAMP gene located at chromosome 3p21 in the human genome. It is the only cathelicidin found in humans, a distinction that makes it unique among antimicrobial peptides. While other mammalian species carry anywhere from one to eleven cathelicidin-encoding genes, humans possess just one, placing the entirety of cathelicidin-mediated innate immunity on LL-37's single sequence and its remarkably broad functional repertoire.

LL-37 is not synthesized in its active form. It exists in storage as part of an 18-kilodalton precursor protein called hCAP-18, held in the cytoplasmic granules of neutrophils, macrophages, natural killer T cells, mast cells, and epithelial cells lining the skin, lungs, and gastrointestinal tract. Upon infection, injury, or inflammatory signaling, hCAP-18 is released and cleaved by serine proteases, specifically kallikreins and proteinase 3, which remove the conserved N-terminal cathelin domain and release the active C-terminal 37-amino acid LL-37 peptide. This proteolytic activation mechanism ensures localized release at sites of infection while preserving systemic host tissue integrity. The name LL-37 derives directly from its structure: two leucine residues at the N-terminus followed by 37 total amino acids.

The broader cathelicidin family to which LL-37 belongs was first characterized in the late 1980s by researchers in Trieste working with antimicrobial extracts from bovine neutrophil granules. Human LL-37 itself was identified and characterized in the mid-1990s, with the Gudmundsson group initially describing a 39-residue C-terminal fragment called FALL-39 in 1995, before subsequent characterization confirmed the mature active peptide is two amino acids shorter, establishing the LL-37 designation that has remained standard. The CAMP gene's vitamin D response element, discovered in subsequent years, revealed that LL-37 expression is directly upregulated by vitamin D, providing a mechanistic link between vitamin D status, innate immune competence, and susceptibility to respiratory and other infections that has become one of the more practically significant findings in the LL-37 literature.

Structurally, LL-37 adopts an amphipathic alpha-helical conformation in membrane-mimicking environments, with positively charged residues concentrated along one face of the helix and hydrophobic residues along the other. This amphipathic architecture is the physical basis for its ability to interact with negatively charged bacterial membranes while remaining selective against host cell membranes under normal physiological conditions. LL-37 also demonstrates structural versatility, forming monomeric, dimeric, and tetrameric assemblies depending on concentration and local environment, with the tetrameric form producing a narrow, charged channel in membrane bilayers that has been directly visualized by X-ray crystallography.


Research Overview

The research base for LL-37 is among the most extensive of any therapeutic peptide, spanning decades of investigation across antimicrobial biology, immunology, wound healing, cardiovascular medicine, oncology, and dermatology, with contributions from research groups across multiple continents operating independently of one another. The breadth of documented biological activities has led researchers to describe LL-37 as a factotum peptide, a term denoting a compound capable of performing a remarkably wide range of functions.

A 2025 systematic review consolidating data from PubMed, Scopus, and Web of Science confirmed LL-37's broad-spectrum antimicrobial activity against gram-positive and gram-negative bacteria, fungi, and viruses, with particular therapeutic promise against drug-resistant organisms including MRSA, vancomycin-resistant Enterococcus (VRE), and resistant Klebsiella. The review documented the structural versatility that enables this broad activity, including mono-, di-, and tetrameric assembly forms that support different functional contexts.

The most significant human clinical trial of LL-37 to date involved diabetic foot ulcers. In a randomized, double-blind, placebo-controlled trial, patients applied either LL-37 cream or placebo twice weekly for four weeks. The LL-37 group achieved significantly higher granulation index values, a parameter reflecting new tissue formation, at every measured time point across the entire follow-up period, including days 7, 14, 21, and 28, demonstrating statistically significant acceleration of tissue regenerative processes in a clinically meaningful human population.

In cardiovascular research, higher plasma LL-37 levels were found to predict lower rates of major adverse cardiovascular events following acute ST-elevation myocardial infarction in a 2022 study in the Journal of Atherosclerosis and Thrombosis, and LL-37 was shown to attenuate cardiac dysfunction in multiple preclinical heart failure models, with circulating levels inversely associated with acute heart failure severity. A 2025 review in Frontiers in Pharmacology identified LL-37 as a promising therapeutic strategy for lower limb ischemic diseases through its angiogenic properties.

The relationship between LL-37 and cancer is complex and context-dependent, a nuance the literature handles with appropriate care. In colorectal cancer, gastric cancer, and certain hematological malignancies, LL-37 demonstrates tumor-suppressive effects, promoting apoptosis, inhibiting angiogenesis that feeds tumors, and maintaining colon mucosal barrier integrity against carcinogenesis. In breast cancer, lung cancer, and certain other solid tumors, LL-37 has been found to promote tumor progression through activation of IGF-1 receptor signaling and EGFR transactivation in cancer cells. This context-dependence is a recurring theme that requires careful consideration before therapeutic application in oncological contexts.


Key Mechanisms

Membrane Disruption and Broad-Spectrum Antimicrobial Activity

LL-37's primary antimicrobial mechanism is physical disruption of microbial cell membranes through its amphipathic helical structure. The positively charged face of the helix is electrostatically attracted to the negatively charged surface of bacterial membranes, which are rich in anionic lipopolysaccharide (LPS) in gram-negative bacteria and lipoteichoic acid (LTA) in gram-positive bacteria. Once bound, LL-37 inserts into the membrane bilayer, with tetrameric channel formation and toroidal pore formation both proposed as mechanisms depending on local concentration and membrane composition. The result is membrane disruption, leakage of cellular contents, and bacterial death within minutes of exposure. Critically, this physical membrane disruption mechanism is fundamentally different from the specific enzymatic or receptor-mediated mechanisms targeted by conventional antibiotics, which is why bacterial resistance to LL-37 develops far more slowly and rarely than resistance to conventional antibiotics, despite LL-37's co-evolution with bacterial communities over millions of years.

LPS Neutralization and Endotoxin Binding

Beyond direct bacterial killing, LL-37 binds and neutralizes bacterial LPS, the primary endotoxin responsible for the septic shock cascade that kills many patients with gram-negative bacteremia. By sequestering LPS before it can activate toll-like receptor 4 (TLR4) signaling on macrophages and endothelial cells, LL-37 prevents the catastrophic cytokine storm that transforms controlled infection into systemic inflammatory response syndrome. In a murine sepsis model, LL-37 improved survival of cecal ligation and puncture animals through three simultaneous mechanisms: suppression of pro-inflammatory macrophage pyroptosis, induction of NETosis with release of neutrophil extracellular traps with potent bactericidal activity, and stimulation of antimicrobial ectosome release from neutrophils, representing a coordinated multi-mechanism defense against systemic infection.

FPRL-1 and P2X7 Receptor-Mediated Immune Modulation

LL-37 acts on host immune cells through the formyl peptide receptor-like 1 (FPRL-1) G protein-coupled receptor, which it uses to chemoattract peripheral blood neutrophils, monocytes, and T-cells to sites of infection and injury. This chemotactic activity orchestrates the cellular immune response by recruiting the appropriate effector cells precisely where they are needed. Through FPRL-1 activation, LL-37 also suppresses neutrophil apoptosis at concentrations below 1 micromolar, extending neutrophil lifespan at infection sites to maintain antimicrobial coverage. Through direct activation of the P2X7 purinergic receptor, LL-37 stimulates IL-1 beta secretion from monocytes, amplifying the inflammatory alarm signal while simultaneously positioning itself to modulate that signal through its anti-inflammatory LPS neutralization activity.

EGFR Transactivation and Wound Healing Signaling

LL-37 activates the epidermal growth factor receptor (EGFR) through transactivation, triggering keratinocyte migration, proliferation, and re-epithelialization at wound sites. This EGFR activation is one of the primary mechanisms behind LL-37's well-documented wound healing effects, promoting the re-epithelialization phase that closes wounds after the initial inflammatory response. Alongside EGFR activation, LL-37 promotes angiogenesis through VEGF-mediated signaling and by directly stimulating endothelial cell proliferation, migration, and tubule formation. In dexamethasone-treated mice, a model of impaired wound healing, topical LL-37 significantly increased vascularization and re-epithelialization, demonstrating that its wound healing activity operates even when conventional healing mechanisms are pharmacologically suppressed.

Anti-Biofilm Activity

One of LL-37's clinically significant properties is its ability to disrupt and prevent bacterial biofilms, the structured microbial communities encased in protective polysaccharide matrices that make infections in chronic wounds, medical devices, and respiratory tissue resistant to conventional antibiotics. LL-37 inhibits biofilm formation at concentrations below its minimum inhibitory concentration for planktonic bacteria, meaning it prevents biofilm establishment more efficiently than it kills free-floating bacteria. It also eradicates preformed biofilms, penetrating the matrix and disrupting the structural organization that protects resident bacteria from immune clearance. This anti-biofilm property is particularly relevant in diabetic wound infections, which are typically polymicrobial biofilm-mediated and represent one of the most treatment-resistant infection scenarios in clinical medicine.

Vitamin D-Dependent Expression Regulation

LL-37 production is directly regulated by vitamin D through a vitamin D response element in the CAMP gene promoter. Vitamin D3 binding to its nuclear receptor triggers transcriptional upregulation of the CAMP gene, increasing LL-37 production in epithelial cells and immune cells. Lower plasma levels of hCAP-18 are associated with significantly increased risk of death from infection in dialysis patients, and epidemiological data consistently links vitamin D deficiency with reduced innate immune competence against respiratory and other infections through this mechanism. This regulatory connection has direct practical relevance: vitamin D optimization is a meaningful adjunct to any protocol involving LL-37, as it supports endogenous production alongside exogenous supplementation.


Common Applications

Antimicrobial Resistance and Infection Management

The most compelling application for LL-37 in contemporary medicine is as an alternative or adjunct to conventional antibiotics in the management of drug-resistant infections. Its membrane-disruption mechanism, which targets conserved physical properties of bacterial membranes rather than specific enzymatic targets, gives it activity against MRSA, VRE, multi-drug resistant Klebsiella, Pseudomonas aeruginosa, and other organisms for which conventional antibiotic options are increasingly limited. The combination of bactericidal activity, LPS neutralization, anti-biofilm properties, and immune recruitment creates a multi-layered antimicrobial profile that no single conventional antibiotic can replicate. LL-37 demonstrates synergistic activity with bactericidal antibiotics that target cell wall structure, amplifying their effect by disrupting the membrane integrity that allows antibiotic access, though it may show antagonistic interactions with bacteriostatic agents through bacterial stress response mechanisms. In immune-compromised patients, where endogenous LL-37 production is reduced, supplementation represents a direct strategy to restore innate antimicrobial defense capacity.

Wound Healing and Diabetic Ulcer Management

The randomized controlled trial data in diabetic ulcers represents the most rigorous human clinical evidence for LL-37 in any application, demonstrating significantly accelerated granulation tissue formation at every time point across a four-week treatment period. The mechanistic basis for this result is well characterized: EGFR-mediated keratinocyte migration, VEGF-driven angiogenesis, anti-biofilm activity against wound pathogens, LPS neutralization reducing inflammatory burden, and direct promotion of endothelial tubule formation all contribute simultaneously to accelerated wound closure. For diabetic wounds specifically, where impaired vascularization, chronic bacterial biofilm, dysregulated inflammation, and impaired keratinocyte migration all converge to create a hostile healing environment, LL-37's capacity to address all of these barriers simultaneously through a single compound is mechanistically distinctive. LL-37 is most commonly applied topically for wound management, with subcutaneous injection used for systemic applications requiring broader distribution.

Chronic Inflammatory and Skin Conditions

LL-37 plays a dual and sometimes paradoxical role in inflammatory skin conditions. In psoriasis, elevated LL-37 levels contribute to pathogenesis by forming complexes with self-DNA released from damaged keratinocytes, which activate plasmacytoid dendritic cells to produce interferon alpha and beta, driving the T-cell-mediated inflammatory cascade. Conversely, LL-37's anti-inflammatory and antimicrobial properties are beneficial in atopic dermatitis, where Staphylococcus aureus colonization is tightly linked to disease severity and patients with AD show reduced LL-37 expression compared to healthy controls. In rosacea, elevated kallikrein processing of cathelicidin into aberrant LL-37 fragments contributes to the condition, though full-length LL-37 itself is not causative. Understanding these condition-specific nuances is essential for appropriate application: LL-37 is most clearly beneficial in wound healing, atopic dermatitis, and chronic infections, while its role in psoriasis requires careful consideration of the inflammatory context.

Immune Resilience and Infection Prevention

Given its role as the body's primary cathelicidin innate immune signal, LL-37 is used in preventive contexts by individuals seeking to enhance baseline innate immune competence, particularly during periods of high infection exposure, physiological stress, travel, or immunosuppression. Its capacity to enhance both innate and adaptive immune response components, coordinate the cellular response to infection through chemotaxis and neutrophil survival extension, and neutralize bacterial endotoxins before they trigger systemic inflammation creates a broad-spectrum immune support profile. It pairs well with Thymosin Alpha-1, which addresses adaptive immune and T-cell components, and with KPV, which provides complementary intracellular NF-kB suppression for inflammatory management.

Cardiovascular Protection and Heart Failure

The inverse correlation between plasma LL-37 levels and major adverse cardiovascular event risk following myocardial infarction, combined with the direct demonstration that LL-37 attenuates cardiac dysfunction in multiple preclinical heart failure models, positions LL-37 as a cardiovascular protective agent with mechanisms extending well beyond its antimicrobial role. Its angiogenic properties are particularly relevant in ischemic cardiovascular disease, where restoration of perfusion to ischemic myocardium through new vessel formation is a central therapeutic goal. A 2025 review specifically identified LL-37 as a therapeutic candidate for lower limb ischemic disease through this angiogenic mechanism. The cardiovascular application of LL-37 remains preclinical in most aspects, but the human correlative data and mechanistic coherence make it a compelling area of ongoing investigation.

Gut Health and Colon Mucosal Protection

LL-37 and its murine homologue CRAMP are expressed by colonic epithelial cells and macrophages, where they maintain colon mucosal barrier integrity, shape microbiota composition, protect against enteric pathogens, and reduce carcinogenic risk at the mucosal surface. Mice genetically deficient in CRAMP show increased susceptibility to colitis and colonic tumorigenesis, demonstrating that cathelicidin signaling is not merely a response to gut infection but a constitutive component of colon homeostasis. LL-37's gut applications parallel KPV in several respects, and the two peptides are considered complementary in gut-focused protocols: KPV addresses intracellular NF-kB inflammatory signaling in intestinal epithelial cells, while LL-37 provides the antimicrobial coverage and mucosal barrier support that prevents the microbial breaches that trigger that inflammatory cascade in the first place.

References

  1. https://pmc.ncbi.nlm.nih.gov/articles/PMC9445486/
  2. https://pmc.ncbi.nlm.nih.gov/articles/PMC11000334/
  3. https://pubmed.ncbi.nlm.nih.gov/21693141/
  4. https://www.sciencedirect.com/science/article/pii/S156713482500142X
  5. https://pmc.ncbi.nlm.nih.gov/articles/PMC8227053/
  6. https://www.sciencedirect.com/science/article/pii/S0005273615003685
  7. https://pubmed.ncbi.nlm.nih.gov/32825174/

Note: This list compiles unique sources referenced throughout the article. For a full bibliography, including additional studies mentioned in the content, consult the original research compilations or databases like PubMed.